Name | CCDC121 antibody |
---|---|
Supplier | Acris Antibodies |
Catalog | TA330738 |
Prices | $325.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Dog, Human, Yeast |
Antigen | The immunogen for Anti-CCDC121 antibody is: synthetic peptide directed towards the middle region of Human CCDC121. Synthetic peptide located within the following region: QLLEESRELHREKLLVQAENRFFLEYLTNKTEEYTEQPEKVWNSYLQKSG. |
Description | Rabbit Polyclonal |
Gene | CCDC121 |
Supplier Page | Shop |