CCDC121 antibody
| Name | CCDC121 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA330738 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Dog, Human, Yeast |
| Antigen | The immunogen for Anti-CCDC121 antibody is: synthetic peptide directed towards the middle region of Human CCDC121. Synthetic peptide located within the following region: QLLEESRELHREKLLVQAENRFFLEYLTNKTEEYTEQPEKVWNSYLQKSG. |
| Description | Rabbit Polyclonal |
| Gene | CCDC121 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: CCDC121; Sample Tissue: OVCAR-3 Whole Cell lysates; Antibody Dilution: 1.0ug/mlCCDC121 is supported by BioGPS gene expression data to be expressed in OVCAR3