Alpha-amylase 1 / AMY1 antibody
| Name | Alpha-amylase 1 / AMY1 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA335064 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Dog, Human, Mouse, Pig, Rabbit, Rat |
| Antigen | The immunogen for anti-Amy1a antibody is: synthetic peptide directed towards the middle region of Rat Amy1a. Synthetic peptide located within the following region: YLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGSSILTFWDARLYKMAV. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | Amy1 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: Amy1a; Sample Tissue: Rat Heart lysates; Antibody Dilution: 1.0 ug/ml