ACOX1 antibody
| Name | ACOX1 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA335908 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Horse, Human, Mouse, Pig, Rabbit, Rat |
| Antigen | The immunogen for Anti-Paox Antibody is: synthetic peptide directed towards the middle region of Rat Paox. Synthetic peptide located within the following region: FQLAAEFGLLGEKELSEENQLVETGGHVALPSVSCTSSGTSVSLELVTEM. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | Acox1 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: Paox; Sample Tissue: Rat Pancreas lysates; Antibody Dilution: 1.0 ug/ml