Name | SLC37A3, Polyclonal Antibody |
---|---|
Supplier | MyBioSource |
Catalog | MBS5302597 |
Prices | $455.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB IHC |
Species Reactivities | Human |
Antigen | SLC37A3 antibody was raised using a synthetic peptide corresponding to a region with amino acids FFGLLVSPEEIGLSGIEAEENFEEDSHRPLINGGENEDEYEPNYSIQDDS |
Purity/Format | Affinity purified |
Description | SLC37A3 antibody |
Gene | SLC37A3 |
Supplier Page | Shop |