Name | RBM47, Polyclonal Antibody |
---|---|
Supplier | MyBioSource |
Catalog | MBS839217 |
Prices | $455.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Dog |
Antigen | RBM47 antibody was raised using the middle region of RBM47 corresponding to a region with amino acids HFTSREDAVHAMNNLNGTELEGSCLEVTLAKPVDKEQYSRYQKAARGGGA |
Purity/Format | Affinity purified |
Description | RBM47 antibody |
Gene | RBM47 |
Supplier Page | Shop |