PXT1, Polyclonal Antibody

Name PXT1, Polyclonal Antibody
Supplier MyBioSource
Catalog MBS5300702
Prices $455.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen PXT1 antibody was raised using the middle region of PXT1 corresponding to a region with amino acids MQLRHIGDNIDHRMVREDLQQDGRDALDHFVFFFFRRVQVLLHFFWNNHL
Purity/Format Affinity purified
Description PXT1 antibody
Gene PXT1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.