FTHL17, Polyclonal Antibody

Name FTHL17, Polyclonal Antibody
Supplier MyBioSource
Catalog MBS5301624
Prices $455.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen FTHL17 antibody was raised using the middle region of FTHL17 corresponding to a region with amino acids FLESHYLHEQVKTIKELGGYVSNLRKICSPEAGLAEYLFDKLTLGGRVKE
Purity/Format Affinity purified
Description FTHL17 antibody
Gene FTHL17
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.