DDX26B, Polyclonal Antibody

Name DDX26B, Polyclonal Antibody
Supplier MyBioSource
Catalog MBS839794
Prices $455.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen DDX26B antibody was raised using a synthetic peptide corresponding to a region with amino acids ASTEPEQLGSVPTDESAITQMCEVTGGRSYCVRTQRMLNQCLESLVQKVQ
Purity/Format Affinity purified
Description DDX26B antibody
Gene DDX26B
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.