| Name | C19ORF15, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS839412 |
| Prices | $455.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | C19ORF15 antibody was raised using the C terminal Of C19Orf15 corresponding to a region with amino acids FFLIQDLVTGDSGSFQGSYVLLVVGGGPTLDSLKDYSEDEIYRFNSPLDK |
| Purity/Format | Affinity purified |
| Description | C19ORF15 antibody |
| Gene | CATSPERG |
| Supplier Page | Shop |