Name | C17ORF64, Polyclonal Antibody |
---|---|
Supplier | MyBioSource |
Catalog | MBS839859 |
Prices | $455.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | C17ORF64 antibody was raised using the middle region of C17Orf64 corresponding to a region with amino acids NMQTPGQGSPLPGQPRSQDHVKKDSLRELSQKPKLKRKRIKEAPETPETE |
Purity/Format | Affinity purified |
Description | C17ORF64 antibody |
Gene | C17orf64 |
Supplier Page | Shop |