| Name | KIAA1430 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3136 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | KIAA1430 antibody was raised using the middle region of KIAA1430 corresponding to a region with amino acids NMGYLNSSPLSRRARSTLGQYSPLRASRTSSATSGLSCRSERSAVDPSSG |
| Purity/Format | Affinity purified |
| Description | Rabbit polyclonal KIAA1430 antibody raised against the middle region of KIAA1430 |
| Gene | CFAP97 |
| Supplier Page | Shop |