Anti-STARD6 (aa 18-67) polyclonal antibody

Name Anti-STARD6 (aa 18-67) polyclonal antibody
Supplier Creative Diagnostics
Catalog DPABH-25493
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen Synthetic peptide corresponding to a region within N terminal amino acids 18-67 (NRDTSGWKVVKTSKKITVSSKASRKFHGNLYRVEGIIPESPAKLSDFLY Q) of Human STARD6 (NP_631910, NM_139171)
Description Rabbit Polyclonal
Gene STARD6
Conjugate Unconjugated
Supplier Page Shop