| Name | Anti-RNF113A (aa 53-102) polyclonal antibody |
|---|---|
| Supplier | Creative Diagnostics |
| Catalog | DPABH-12707 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide within Human RNF113A aa 53-102 (N terminal). The exact sequence is proprietary.Sequence: VVRPEKKRVTHNPMIQKTRDSGKQKAAYGDLSSEEEEENEPESLGVVYKS Database link: O15541 Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | RNF113A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |