Anti-POLR2K (aa 1-50) polyclonal antibody

Name Anti-POLR2K (aa 1-50) polyclonal antibody
Supplier Creative Diagnostics
Catalog DPABH-18517
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen Synthetic peptide corresponding to a region within the internal sequence amino acids 1-50 (DTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTK R) of Human POLR2K (NP_005025).
Description Rabbit Polyclonal
Gene POLR2K
Conjugate Unconjugated
Supplier Page Shop