| Name | Anti-PLAC9 (aa 48-97) polyclonal antibody |
|---|---|
| Supplier | Creative Diagnostics |
| Catalog | DPABH-18742 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide corresponding to a region within the internal sequence amino acids 48-97 of Human PLAC9 (RLDVMEEMVEKTVDHLGTEVKGLLGLLEELAWNLPPGPFSPAPDLLGDG F) NP_001012991 |
| Description | Rabbit Polyclonal |
| Gene | PLAC9 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |