Name | Anti-FAM166A (aa 38-87) polyclonal antibody |
---|---|
Supplier | Creative Diagnostics |
Catalog | DPABH-12697 |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptide within Human FAM166A aa 38-87 (N terminal). The exact sequence is proprietary. (NP_001001710).Sequence: TTGQLLTDPSVQKSPCSVLSPMSKPKFIEDFSQSKPPRVPCQDLTEPYIP Database link: Q6J272 Run BLAST with Run BLAST with |
Description | Rabbit Polyclonal |
Gene | FAM166A |
Conjugate | Unconjugated |
Supplier Page | Shop |