Anti-COQ5 (aa 41-90) polyclonal antibody

Name Anti-COQ5 (aa 41-90) polyclonal antibody
Supplier Creative Diagnostics
Catalog DPABH-29120
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Rat
Antigen Synthetic peptide corresponding to a region within N-terminal amino acids 41-90 (RSLSQEKRAAETHFGFETVSEKEKGGKVYQVFQSVARKYDLMNDMMSLG I) of Rat COQ5 (NP_001034111).
Description Rabbit Polyclonal
Gene Coq5
Conjugate Unconjugated
Supplier Page Shop