Name | PDLIM1 Antibody |
---|---|
Supplier | Genway Biotech |
Catalog | GWB-207473 |
Prices | $268.00 |
Sizes | 100 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Mouse |
Antigen | Synthetic Peptide within the following region: TSASGEEANSRPVVQPHPSGSLIIDKDSEVYKMLQEKQELNEPPKQSTSF |
Purity/Format | Lyophilized powder. Add 100 ul of distilled water. Final anti-PDLIM1 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. |
Description | Rabbit Polyclonal |
Gene | Pdlim1 |
Supplier Page | Shop |