| Name | 4930567H17Rik Antibody |
|---|---|
| Supplier | Genway Biotech |
| Catalog | GWB-ML142G |
| Prices | $368.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Applications | WB |
| Species Reactivities | Mouse |
| Antigen | Synthetic Peptide within the following region: TLSSYDPCRYILKAALSVITAWENTLEEEEEDEEEDEEEEEMEEEDEGEE |
| Purity/Format | Lyophilized powder. Add 50 ul of distilled water. Final anti-4930567H17Rik antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. |
| Description | Rabbit |
| Gene | 4930567H17Rik |
| Supplier Page | Shop |