| Name | ECHDC3 Antibody |
|---|---|
| Supplier | Genway Biotech |
| Catalog | GWB-MR324I |
| Prices | $294.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Human, Mouse, Pig |
| Antigen | Synthetic Peptide within the following region: SLAMLKSLQSDILHDADSNDLKVIIISAEGPVFSSGHDLKELTEEQGRDY |
| Purity/Format | Lyophilized powder. Add 100 ul of distilled water. Final anti-ECHDC3 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. |
| Description | Rabbit Polyclonal |
| Gene | ECHDC3 |
| Supplier Page | Shop |