Anti-STARD6 antibody - N-terminal
| Name | Anti-STARD6 antibody - N-terminal |
|---|---|
| Supplier | Abcam |
| Catalog | ab133928 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Rat, Rabbit, Bovine, Cat, Dog |
| Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 18-67 ( NRDTSGWKVVKTSKKITVSSKASRKFHGNLYRVEGIIPESPAKLSDFLYQ ) of Human STARD6 (NP_631910, NM_139171) Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | STARD6 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-STARD6 antibody - N-terminal (ab133928) at 1 µg/ml + Human fetal kidney lysate with 5% skimmed milk