Name | Anti-SPATA6 antibody - C-terminal |
---|---|
Supplier | Abcam |
Catalog | ab135353 |
Prices | $359.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Rat, Mouse, Rabbit, Horse, Guinea Pig, Bovine, Cat, Dog, Human, Pig |
Antigen | Synthetic peptide corresponding to a region within C terminal amino acids 382-431 ( RVKDVLKSHQAHGRHLCEERDPEKEDELELKRSLLYRDSAYDSDPEYSSF ) of Rat SPATA6 |
Description | Rabbit Polyclonal |
Gene | SPATA6 |
Conjugate | Unconjugated |
Supplier Page | Shop |