Anti-SPATA6 antibody - C-terminal
| Name | Anti-SPATA6 antibody - C-terminal |
|---|---|
| Supplier | Abcam |
| Catalog | ab135353 |
| Prices | $359.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Rat, Mouse, Rabbit, Horse, Guinea Pig, Bovine, Cat, Dog, Human, Pig |
| Antigen | Synthetic peptide corresponding to a region within C terminal amino acids 382-431 ( RVKDVLKSHQAHGRHLCEERDPEKEDELELKRSLLYRDSAYDSDPEYSSF ) of Rat SPATA6 |
| Description | Rabbit Polyclonal |
| Gene | SPATA6 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-SPATA6 antibody - C-terminal (ab135353) at 1 µg/ml + Rat testis lysate at 10 µg