Name | Anti-SLC26A10 antibody |
---|---|
Supplier | Abcam |
Catalog | ab86347 |
Prices | $370.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 2 - 51 (RLDLASLMSAPKSLGSAFKSWRLDKAPSPQHTFPSTSIPGMAFALLASV P) of Human SLC26A10 (NP_597996) |
Description | Rabbit Polyclonal |
Gene | SLC26A10 |
Conjugate | Unconjugated |
Supplier Page | Shop |