Anti-SLC26A10 antibody
| Name | Anti-SLC26A10 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab86347 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 2 - 51 (RLDLASLMSAPKSLGSAFKSWRLDKAPSPQHTFPSTSIPGMAFALLASV P) of Human SLC26A10 (NP_597996) |
| Description | Rabbit Polyclonal |
| Gene | SLC26A10 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-SLC26A10 antibody (ab86347) at 1 µg/ml (in 5% skim milk / PBS buffer) + HepG2 cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution