Anti-SERPINB13 antibody
| Name | Anti-SERPINB13 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab97943 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Guinea Pig, Bovine, Cat, Dog |
| Antigen | synthetic peptide corresponding to a region within N terminal amino acids 107-156 ( RLFGEKTYLFLQKYLDYVEKYYHASLEPVDFVNAADESRKKINSWVESKT ) of Human SERPINB13 (NP_036529) Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | SERPINB13 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-SERPINB13 antibody (ab97943) at 1 µg/ml + COLO205 cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution