Name | Anti-Secretory phospholipase A2 Type V antibody |
---|---|
Supplier | Abcam |
Catalog | ab97848 |
Prices | $370.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human, Rat, Horse, Guinea Pig, Bovine, Cat, Dog |
Antigen | Synthetic peptide corresponding to a region within internal amino acids 88 - 137 ( YRFAWGVVTCEPGPFCHVNLCACDRKLVYCLKRNLRSYNPQYQYFPNILC ) of Human Secretory phospholipase A2 Type V (NP_000920) |
Description | Rabbit Polyclonal |
Gene | PLA2G5 |
Conjugate | Unconjugated |
Supplier Page | Shop |