Anti-Secretory phospholipase A2 Type V antibody
| Name | Anti-Secretory phospholipase A2 Type V antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab97847 |
| Prices | $376.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Bovine, Cat, Dog |
| Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 1 - 50 ( MKGLLPLAWFLACSVPAVQGGLLDLKSMIEKVTGKNALTNYGFYGCYCGW ) of Human Secretory phospholipase A2 Type V (NP_000920) |
| Description | Rabbit Polyclonal |
| Gene | PLA2G5 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-Secretory phospholipase A2 Type V antibody (ab97847) at 1 µg/ml (in 5% skim milk / PBS buffer) + Human fetal thymus cell lysate at 10 µgSecondaryHRP-conjugated anti-Rabbit IgG at 1/50000 dilution