Name | Anti-RFX1 antibody |
---|---|
Supplier | Abcam |
Catalog | ab87171 |
Prices | $370.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Horse, Guinea Pig, Bovine, Cat, Dog, Yeast |
Antigen | Synthetic peptide corresponding to a region within the internal sequence amino acids 900-949 (ETPIAVMGEFANLATSLNPLDPDKDEEEEEEEESEDELPQDISLAAGGE S) of Human RFX1 (NP_002909) |
Description | Rabbit Polyclonal |
Gene | RFX1 |
Conjugate | Unconjugated |
Supplier Page | Shop |