Anti-RFX1 antibody

Name Anti-RFX1 antibody
Supplier Abcam
Catalog ab87171
Prices $370.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human, Mouse, Rat, Horse, Guinea Pig, Bovine, Cat, Dog, Yeast
Antigen Synthetic peptide corresponding to a region within the internal sequence amino acids 900-949 (ETPIAVMGEFANLATSLNPLDPDKDEEEEEEEESEDELPQDISLAAGGE S) of Human RFX1 (NP_002909)
Description Rabbit Polyclonal
Gene RFX1
Conjugate Unconjugated
Supplier Page Shop

Product images