Anti-RBM42 antibody
| Name | Anti-RBM42 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab102582 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Guinea Pig, Bovine, Cat, Dog |
| Antigen | Synthetic peptide corresponding to a region within internal sequence amino acids 321-372, RPRPPRPEPPPGLMALEVPEPLGEDKKKGKPEKLKRCIRTAAGSSWEDPS , of Human RBM42 (NP_077297) |
| Description | Rabbit Polyclonal |
| Gene | RBM42 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-RBM42 antibody (ab102582) at 1 µg/ml + HepG2 cell lysate at 10 µg