Anti-RAG1 antibody
| Name | Anti-RAG1 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab113821 |
| Prices | $370.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Mouse, Rat, Horse, Human, Pig |
| Antigen | Synthetic peptide corresponding to a region within C terminal amino acids 946- 995( IIERDGSIGAWASEGNESGNKLFRRFRKMNARQSKCYEMEDVLKHHWLYT ) of Mouse RAG1 (NP_033045) |
| Description | Rabbit Polyclonal |
| Gene | RAG1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-RAG1 antibody (ab113821) at 1 µg/ml + Mouse liver lysate at 10 µg