Anti-RAG1 antibody

Name Anti-RAG1 antibody
Supplier Abcam
Catalog ab113821
Prices $370.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Mouse, Rat, Horse, Human, Pig
Antigen Synthetic peptide corresponding to a region within C terminal amino acids 946- 995( IIERDGSIGAWASEGNESGNKLFRRFRKMNARQSKCYEMEDVLKHHWLYT ) of Mouse RAG1 (NP_033045)
Description Rabbit Polyclonal
Gene RAG1
Conjugate Unconjugated
Supplier Page Shop

Product images