Anti-POLR2K antibody
| Name | Anti-POLR2K antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab84336 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Zebrafish |
| Antigen | Synthetic peptide corresponding to a region within the internal sequence amino acids 1-50 (DTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTK R) of Human POLR2K (NP_005025) |
| Description | Rabbit Polyclonal |
| Gene | POLR2K |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-POLR2K antibody (ab84336) at 1 µg/ml + Human Fetal Brain Lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1: 50,000