Anti-PLAC9 antibody
| Name | Anti-PLAC9 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab86234 |
| Prices | $370.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Bovine, Pig |
| Antigen | Synthetic peptide corresponding to a region within the internal sequence amino acids 48-97 of Human PLAC9 ( RLDVMEEMVEKTVDHLGTEVKGLLGLLEELAWNLPPGPFSPAPDLLGDGF ) NP_001012991 Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | PLAC9 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-PLAC9 antibody (ab86234) at 1 µg/ml (in 5% skim milk / PBS buffer) + Fetal heart lysate (Human) at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution