Anti-Phospholipase D2 antibody
| Name | Anti-Phospholipase D2 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab86437 |
| Prices | $370.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Rabbit, Horse, Bovine, Cat, Dog |
| Antigen | Synthetic peptide ( TATPESLFPTGDELDSSQLQMESDEVDTLKEGEDPADRMHPFLAIYELQS ) corresponding to a region within the N terminal amino acids 2-51 of Human Phospholipase D2 (NP_002654) Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | PLD2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-Phospholipase D2 antibody (ab86437) at 1 µg/ml + Transfected 293T cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution