Name | Anti-Phospholipase D2 antibody |
---|---|
Supplier | Abcam |
Catalog | ab86437 |
Prices | $370.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human, Rabbit, Horse, Bovine, Cat, Dog |
Antigen | Synthetic peptide ( TATPESLFPTGDELDSSQLQMESDEVDTLKEGEDPADRMHPFLAIYELQS ) corresponding to a region within the N terminal amino acids 2-51 of Human Phospholipase D2 (NP_002654) Run BLAST with Run BLAST with |
Description | Rabbit Polyclonal |
Gene | PLD2 |
Conjugate | Unconjugated |
Supplier Page | Shop |