| Name | Anti-Leptin antibody [BDI142] |
|---|---|
| Supplier | Abcam |
| Catalog | ab20115 |
| Prices | $372.00 |
| Sizes | 50 µl |
| Host | Mouse |
| Clonality | Monoclonal |
| Isotype | IgG2a |
| Clone | BDI142 |
| Applications | IHC-F ICC/IF ICC/IF ELISA ICC/IF |
| Species Reactivities | Human |
| Antigen | Synthetic peptide: RNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYS TEV , corresponding to amino acids 92-145 of Human Leptin |
| Description | Mouse Monoclonal |
| Gene | LEP |
| Conjugate | Unconjugated |
| Supplier Page | Shop |