Anti-L2 antibody
| Name | Anti-L2 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab89865 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Yeast |
| Antigen | Synthetic peptide corresponding to a region within the internal sequence amino acids 432-481 (DMERYPYVGILHVRDSLIPPQSRRRMKRVWDRAVEFLASNESRIQTESH R), of Human L2 (NP_851853) |
| Description | Rabbit Polyclonal |
| Gene | LEMD2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-L2 antibody (ab89865) at 1 µg/ml + 721_B cell lysate at 10 µg