Name | Anti-L2 antibody |
---|---|
Supplier | Abcam |
Catalog | ab89865 |
Prices | $370.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Yeast |
Antigen | Synthetic peptide corresponding to a region within the internal sequence amino acids 432-481 (DMERYPYVGILHVRDSLIPPQSRRRMKRVWDRAVEFLASNESRIQTESH R), of Human L2 (NP_851853) |
Description | Rabbit Polyclonal |
Gene | LEMD2 |
Conjugate | Unconjugated |
Supplier Page | Shop |