Anti-KLF12 antibody
| Name | Anti-KLF12 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab90702 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Pig, Zebrafish |
| Antigen | Synthetic peptide corresponding to a region within internal amino acids 72 - 121 (VDHFQTQTEPVDLSINKARTSPTAVSSSPVSMTASASSPSSTSTSSSSS S) of Human KLF12 (EAW80528) |
| Description | Rabbit Polyclonal |
| Gene | KLF12 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-KLF12 antibody (ab90702) at 1 µg/ml + OVCAR-3 cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution