Name | Anti-KIAA1024 antibody |
---|---|
Supplier | Abcam |
Catalog | ab82753 |
Prices | $370.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Horse, Guinea Pig, Bovine, Dog |
Antigen | Synthetic peptide corresponding to a region within C terminal amino acids 755-804 (DNKDWHRKSKEADRQYDIPPQHRLPKQPKDGFLVEQVFSPHPYPASLKA H) of Human KIAA1024 (NP_056021) |
Description | Rabbit Polyclonal |
Gene | KIAA1024 |
Conjugate | Unconjugated |
Supplier Page | Shop |