Anti-hunchback antibody
| Name | Anti-hunchback antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab105674 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Drosophila, Rat |
| Antigen | Synthetic peptide corresponding to a region within N-terminal amino acids 1-50 (MQNWETTATTNYEQHNAWYNSMFAANIKQEPGHHLDGNSVASSPRQSPI P) of Human hunchback (NP_731268) |
| Description | Rabbit Polyclonal |
| Gene | hb |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-hunchback antibody (ab105674) at 0.25 µg/ml + Drosophila Cell Lysate at 10 µg