| Name | POLR3F antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2962 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | POLR3F antibody was raised using the N terminal of POLR3F corresponding to a region with amino acids MAEVKVKVQPPDADPVEIENRIIELCHQFPHGITDQVIQNEMPHIEAQQR |
| Purity/Format | Affinity purified |
| Blocking Peptide | POLR3F Blocking Peptide |
| Description | Rabbit polyclonal POLR3F antibody raised against the N terminal of POLR3F |
| Gene | POLR3F |
| Supplier Page | Shop |