Name | FTCD antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-2476 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | FTCD antibody was raised using the middle region of FTCD corresponding to a region with amino acids KFLIAFNINLLGTKEQAHRIALNLREQGRGKDQPGRLKKVQGIGWYLDEK |
Purity/Format | Affinity purified |
Blocking Peptide | FTCD Blocking Peptide |
Description | Rabbit polyclonal FTCD antibody raised against the middle region of FTCD |
Gene | FTCD |
Supplier Page | Shop |