FTCD antibody

Name FTCD antibody
Supplier Fitzgerald
Catalog 70R-2476
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen FTCD antibody was raised using the middle region of FTCD corresponding to a region with amino acids KFLIAFNINLLGTKEQAHRIALNLREQGRGKDQPGRLKKVQGIGWYLDEK
Purity/Format Affinity purified
Blocking Peptide FTCD Blocking Peptide
Description Rabbit polyclonal FTCD antibody raised against the middle region of FTCD
Gene FTCD
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.