VPS54 antibody

Name VPS54 antibody
Supplier Fitzgerald
Catalog 70R-3690
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen VPS54 antibody was raised using a synthetic peptide corresponding to a region with amino acids FYLPQISKEHFTVYQQEISQREKIHERCKNICPPKDTFERTLLHTHDKSR
Purity/Format Affinity purified
Blocking Peptide VPS54 Blocking Peptide
Description Rabbit polyclonal VPS54 antibody
Gene VPS54
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.