SARS antibody

Name SARS antibody
Supplier Fitzgerald
Catalog 70R-1445
Prices $275.00
Sizes 100 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Dog
Antigen SARS antibody was raised using the middle region of SARS corresponding to a region with amino acids SQFDEELYKVIGKGSEKSDDNSYDEKYLIATSEQPIAALHRDEWLRPEDL
Purity/Format Total IgG Protein A purified
Blocking Peptide SARS Blocking Peptide
Description Rabbit polyclonal SARS antibody raised against the middle region of SARS
Gene SARS
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.