| Name | SARS antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1445 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Dog |
| Antigen | SARS antibody was raised using the middle region of SARS corresponding to a region with amino acids SQFDEELYKVIGKGSEKSDDNSYDEKYLIATSEQPIAALHRDEWLRPEDL |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | SARS Blocking Peptide |
| Description | Rabbit polyclonal SARS antibody raised against the middle region of SARS |
| Gene | SARS |
| Supplier Page | Shop |