Name | ApoB antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-7483 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | ApoB antibody was raised using the middle region of APOB corresponding to a region with amino acids SPDKKLTIFKTELRVRESDEETQIKVNWEEEAASGLLTSLKDNVPKATGV |
Purity/Format | Affinity purified |
Blocking Peptide | ApoB Blocking Peptide |
Description | Rabbit polyclonal ApoB antibody raised against the middle region of APOB |
Gene | APOB |
Supplier Page | Shop |