| Name | CCDC46 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1954 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | CCDC46 antibody was raised using the C terminal of CCDC46 corresponding to a region with amino acids IEKEYTQKLAKSSQIIAELQTTISSLKEENSQQQLAAERRLQDVRQKFED |
| Purity/Format | Affinity purified |
| Blocking Peptide | CCDC46 Blocking Peptide |
| Description | Rabbit polyclonal CCDC46 antibody raised against the C terminal of CCDC46 |
| Gene | CEP112 |
| Supplier Page | Shop |