| Name | ACLY antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3904 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | ACLY antibody was raised using the middle region of ACLY corresponding to a region with amino acids LRSAYDSTMETMNYAQIRTIAIIAEGIPEALTRKLIKKADQKGVTIIGPA |
| Purity/Format | Affinity purified |
| Blocking Peptide | ACLY Blocking Peptide |
| Description | Rabbit polyclonal ACLY antibody raised against the middle region of ACLY |
| Gene | ACLY |
| Supplier Page | Shop |