IGFBP4 antibody

Name IGFBP4 antibody
Supplier Fitzgerald
Catalog 70R-5309
Prices $375.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen IGFBP4 antibody was raised using the middle region of IGFBP4 corresponding to a region with amino acids RALERLAASQSRTHEDLYIIPIPNCDRNGNFHPKQCHPALDGQRGKCWCV
Purity/Format Affinity purified
Blocking Peptide IGFBP4 Blocking Peptide
Description Rabbit polyclonal IGFBP4 antibody raised against the middle region of IGFBP4
Gene IGFBP4
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.