| Name | SHB antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5789 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | SHB antibody was raised using the N terminal of SHB corresponding to a region with amino acids MAKWLNKYFSLGNSKTKSPPQPPRPDYREQRRRGERPSQPPQAVPQASSA |
| Purity/Format | Affinity purified |
| Blocking Peptide | SHB Blocking Peptide |
| Description | Rabbit polyclonal SHB antibody raised against the N terminal of SHB |
| Gene | SHB |
| Supplier Page | Shop |