HSPB8 antibody

Name HSPB8 antibody
Supplier Fitzgerald
Catalog 70R-2328
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen HSPB8 antibody was raised using the N terminal of HSPB8 corresponding to a region with amino acids ADGQMPFSCHYPSRLRRDPFRDSPLSSRLLDDGFGMDPFPDDLTASWPDW
Purity/Format Affinity purified
Blocking Peptide HSPB8 Blocking Peptide
Description Rabbit polyclonal HSPB8 antibody raised against the N terminal of HSPB8
Gene HSPB8
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.