SUV39H2 antibody

Name SUV39H2 antibody
Supplier Fitzgerald
Catalog 70R-4560
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen SUV39H2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LDTRLPRIALFSTRTINAGEELTFDYQMKGSGDISSDSIDHSPAKKRVRT
Purity/Format Affinity purified
Blocking Peptide SUV39H2 Blocking Peptide
Description Rabbit polyclonal SUV39H2 antibody
Gene SUV39H2
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.