| Name | HAL antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1179 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | HAL antibody was raised using the C terminal of HAL corresponding to a region with amino acids EAAHRLLLEQKVWEVAAPYIEKYRMEHIPESRPLSPTAFSLQFLHKKSTK |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | HAL Blocking Peptide |
| Description | Rabbit polyclonal HAL antibody raised against the C terminal of HAL |
| Gene | AKR1B10 |
| Supplier Page | Shop |