| Name | KCNH5 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5121 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Dog |
| Antigen | KCNH5 antibody was raised using a synthetic peptide corresponding to a region with amino acids LTNSRSVLQQLTPMNKTEVVHKHSRLAEVLQLGSDILPQYKQEAPKTPPH |
| Purity/Format | Affinity purified |
| Blocking Peptide | KCNH5 Blocking Peptide |
| Description | Rabbit polyclonal KCNH5 antibody |
| Gene | KCNH5 |
| Supplier Page | Shop |